PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g20540.1.p
Common NameBRADI_1g20540, LOC100826913
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 325aa    MW: 34345.3 Da    PI: 8.1224
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g20540.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ lv +++ +G+g+W++++ + g++R+ k+c++rw +yl
  Bradi1g20540.1.p 14 KGPWTPEEDLVLVSYIQDHGPGNWRSVPTRTGLKRCSKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding52.31.3e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T++E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Bradi1g20540.1.p  67 RGNFTAQEEKLIVHLQALLGNR-WAAIASYLP-DRTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.444965IPR017930Myb domain
SuperFamilySSF466893.67E-3011108IPR009057Homeodomain-like
SMARTSM007174.8E-141363IPR001005SANT/Myb domain
PfamPF002498.9E-161461IPR001005SANT/Myb domain
CDDcd001679.44E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129420.78566116IPR017930Myb domain
SMARTSM007171.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.9E-1567112IPR001005SANT/Myb domain
CDDcd001676.22E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MGRPPCCDKD GVKKGPWTPE EDLVLVSYIQ DHGPGNWRSV PTRTGLKRCS KSCRLRWTNY  60
LRPGIKRGNF TAQEEKLIVH LQALLGNRWA AIASYLPDRT DNDIKNYWNT HLRRKLQLQA  120
DGVSPSSSKP ATAANKSSSS AAASTKGQWE RRLQTDIGLA RRALREALTA IRDGDEEEDD  180
DIKPQAASGE SPAASSSSGA SMSISMSQPT PYVLTADNVA RMLDGWSKSS KGRAAAADSP  240
PSSGSSASEL SCGGAAASEC VRKPAVSAPA PEQPSELSAI ETWLFADDVS NAVGFLGHGH  300
GYGGGLLDGP NPGLLGGGLL DGRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27141164105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-27141164105C-Myb DNA-Binding Domain
1msf_C2e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559924.20.0PREDICTED: transcription factor MYB30-like
SwissprotP813922e-92MYB06_ANTMA; Myb-related protein 306
TrEMBLI1GS260.0I1GS26_BRADI; Uncharacterized protein
STRINGBRADI1G20540.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.23e-83myb domain protein 96